CA8 antibody (Middle Region)

Catalog No. ABIN631159

This Rabbit Polyclonal antibody specifically detects CA8 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for CA8 antibody (Middle Region) (ABIN631159)

Target: CA8 (Carbonic Anhydrase VIII (CA8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CA8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CA8 Antibody

Binding Specificity: Middle Region

Specificity: Carbonic Anhydrase VIII antibody was raised against the middle region of CA8

Purification: Affinity purified

Immunogen: Carbonic Anhydrase VIII antibody was raised using the middle region of CA8 corresponding to a region with amino acids TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carbonic Anhydrase VIII Blocking Peptide, (ABIN5612607), is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase VIII antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CA8

Target: CA8 (Carbonic Anhydrase VIII (CA8))

Alternative Name: Carbonic Anhydrase VIII

Background: CA8 was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, CA8 lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). CA8 continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family.

Molecular Weight: 33 kDa (MW of target protein)