MTPN antibody (Middle Region)

Catalog No. ABIN631163

The Rabbit Polyclonal anti-MTPN antibody has been validated for WB. It is suitable to detect MTPN in samples from Human, Mouse, Rat and Dog.

Quick Overview for MTPN antibody (Middle Region) (ABIN631163)

Target: MTPN (Myotrophin (MTPN))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTPN antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MTPN Antibody

Binding Specificity: Middle Region

Specificity: Myotrophin antibody was raised against the middle region of MTPN

Purification: Affinity purified

Immunogen: Myotrophin antibody was raised using the middle region of MTPN corresponding to a region with amino acids GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Myotrophin Blocking Peptide, (ABIN938920), is also available for use as a blocking control in assays to test for specificity of this Myotrophin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTPN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTPN

Target: MTPN (Myotrophin (MTPN))

Alternative Name: Myotrophin

Background: MTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy.

Molecular Weight: 13 kDa (MW of target protein)