ACSBG2 antibody (Middle Region)

Catalog No. ABIN631171

Product Details anti-ACSBG2 Antibody

Target: ACSBG2 (Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACSBG2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACSBG2 antibody was raised against the middle region of ACSBG2

Purification: Affinity purified

Immunogen: ACSBG2 antibody was raised using the middle region of ACSBG2 corresponding to a region with amino acids LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACSBG2 Blocking Peptide, catalog no. 33R-5237, is also available for use as a blocking control in assays to test for specificity of this ACSBG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSBG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACSBG2

Target: ACSBG2 (Acyl-CoA Synthetase Bubblegum Family Member 2 (ACSBG2))

Alternative Name: ACSBG2 (ACSBG2 Products)

Synonyms: ACSBG2 antibody, fk81d02 antibody, im:7046047 antibody, sb:cb76 antibody, si:dkey-240a9.3 antibody, wu:fj55d04 antibody, wu:fk81d02 antibody, BGR antibody, BRGL antibody, PRTD-NY3 antibody, PRTDNY3 antibody, Bgr antibody, acyl-CoA synthetase bubblegum family member 2 antibody, long-chain-fatty-acid--CoA ligase ACSBG2 antibody, acyl-CoA synthetase bubblegum family member 2 L homeolog antibody, ACSBG2 antibody, LOC476732 antibody, acsbg2 antibody, acsbg2.L antibody, Acsbg2 antibody

Background: ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids, however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process