ACTR2 antibody

Catalog No. ABIN631175

Product Details anti-ACTR2 Antibody

Target: ACTR2 (Actin-Related Protein 2 (ACTR2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACTR2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACTR2 Blocking Peptide, catalog no. 33R-7879, is also available for use as a blocking control in assays to test for specificity of this ACTR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACTR2

Target: ACTR2 (Actin-Related Protein 2 (ACTR2))

Alternative Name: ACTR2 (ACTR2 Products)

Background: ACTR2 is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. The specific function of this gene has not yet been determined.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: RTK Signaling, Regulation of Actin Filament Polymerization