OMP antibody (Middle Region)

Catalog No. ABIN631184

The Rabbit Polyclonal anti-OMP antibody has been validated for WB. It is suitable to detect OMP in samples from Human, Rat and Mouse.

Quick Overview for OMP antibody (Middle Region) (ABIN631184)

Target: OMP (Olfactory Marker Protein (OMP))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OMP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OMP Antibody

Binding Specificity: Middle Region

Specificity: OMP antibody was raised against the middle region of OMP

Purification: Affinity purified

Immunogen: OMP antibody was raised using the middle region of OMP corresponding to a region with amino acids WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OMP Blocking Peptide, (ABIN935955), is also available for use as a blocking control in assays to test for specificity of this OMP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OMP

Target: OMP (Olfactory Marker Protein (OMP))

Alternative Name: OMP

Background: Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human.

Molecular Weight: 19 kDa (MW of target protein)