NGRN antibody (N-Term)

Catalog No. ABIN631192

Product Details anti-NGRN Antibody

Target: NGRN (Neugrin, Neurite Outgrowth Associated (NGRN))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NGRN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NGRN antibody was raised against the N terminal of NGRN

Purification: Affinity purified

Immunogen: NGRN antibody was raised using the N terminal of NGRN corresponding to a region with amino acids MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NGRN Blocking Peptide, catalog no. 33R-5804, is also available for use as a blocking control in assays to test for specificity of this NGRN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NGRN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NGRN

Target: NGRN (Neugrin, Neurite Outgrowth Associated (NGRN))

Alternative Name: NGRN (NGRN Products)

Synonyms: Ngrn antibody, zgc:136784 antibody, dsc92 antibody, Neugrin antibody, DKFZp469B131 antibody, DSC92 antibody, AW552001 antibody, neugrin, neurite outgrowth associated antibody, ngrn antibody, NGRN antibody, Ngrn antibody

Background: NGRN may be involved in neuronal differentiation.

Molecular Weight: 32 kDa (MW of target protein)