PFN1 antibody (N-Term)

Catalog No. ABIN631215

Product Details anti-PFN1 Antibody

Target: PFN1 (Profilin 1 (PFN1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PFN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Profilin 1 antibody was raised against the N terminal of PFN1

Purification: Affinity purified

Immunogen: Profilin 1 antibody was raised using the N terminal of PFN1 corresponding to a region with amino acids AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Profilin 1 Blocking Peptide, catalog no. 33R-1234, is also available for use as a blocking control in assays to test for specificity of this Profilin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PFN1

Target: PFN1 (Profilin 1 (PFN1))

Alternative Name: Profilin 1 (PFN1 Products)

Synonyms: GmPRO1 antibody, GmPRO2 antibody, PRO1 antibody, Profilin-1 antibody, profilin-1 antibody, profilin antibody, MGC130883 antibody, Profilin1 antibody, XProfilin1 antibody, sb:cb813 antibody, wu:fa91a03 antibody, ALS18 antibody, Pfn antibody, F6F22.21 antibody, F6F22_21 antibody, PFN1 antibody, PROFILIN 1 antibody, profilin 1 antibody, profilin antibody, profilin 1 antibody, profilin 1 L homeolog antibody, profilin homolog 1 antibody, Profilin-1 antibody, PRO2 antibody, PFN1 antibody, pfn1.L antibody, pfn1 antibody, Pfn1 antibody, PRF1 antibody, prf1 antibody, pfn-1 antibody

Background: PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome.

Molecular Weight: 15 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization, Tube Formation, Maintenance of Protein Location