GALT antibody (C-Term)

Catalog No. ABIN631216

This Rabbit Polyclonal antibody specifically detects GALT in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for GALT antibody (C-Term) (ABIN631216)

Target: GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GALT Antibody

Binding Specificity: C-Term

Specificity: GALT antibody was raised against the C terminal of GALT

Purification: Affinity purified

Immunogen: GALT antibody was raised using the C terminal of GALT corresponding to a region with amino acids LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALT Blocking Peptide, (ABIN5613721), is also available for use as a blocking control in assays to test for specificity of this GALT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GALT

Target: GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))

Alternative Name: GALT

Background: Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet.

Molecular Weight: 43 kDa (MW of target protein)