UBR2 antibody (C-Term)

Catalog No. ABIN631224

Product Details anti-UBR2 Antibody

Target: UBR2 (Ubiquitin Protein Ligase E3 Component N-Recognin 2 (UBR2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UBR2 antibody was raised against the C terminal of UBR2

Purification: Affinity purified

Immunogen: UBR2 antibody was raised using the C terminal of UBR2 corresponding to a region with amino acids QGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGIDWQHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBR2 Blocking Peptide, catalog no. 33R-7566, is also available for use as a blocking control in assays to test for specificity of this UBR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBR2

Target: UBR2 (Ubiquitin Protein Ligase E3 Component N-Recognin 2 (UBR2))

Alternative Name: UBR2 (UBR2 Products)

Synonyms: ba49a4.1 antibody, si:ch211-239i4.2 antibody, C6orf133 antibody, RP3-392M17.3 antibody, bA49A4.1 antibody, dJ242G1.1 antibody, dJ392M17.3 antibody, 9930021A08Rik antibody, AI462103 antibody, AW540746 antibody, E130209G04Rik antibody, mKIAA0349 antibody, ubiquitin protein ligase E3 component n-recognin 2 antibody, ubiquitin protein ligase E3 component n-recognin 2 S homeolog antibody, UBR2 antibody, ubr2 antibody, ubr2.S antibody, Ubr2 antibody

Background: Proteolysis by the ubiquitin-proteasome system controls the concentration of many regulatory proteins. The selectivity of ubiquitylation is determined by ubiquitin E3 ligases, which recognise the substrate's destabilization signal, or degron. The E3 ligase UBR2 participates in the N-end rule pathway, which targets proteins bearing an N-terminal degron, or N-degron.

Molecular Weight: 200 kDa (MW of target protein)