WASF3 antibody (N-Term)

Catalog No. ABIN631248

This anti-WASF3 antibody is a Rabbit Polyclonal antibody detecting WASF3 in WB. Suitable for Human.

Quick Overview for WASF3 antibody (N-Term) (ABIN631248)

Target: WASF3 (WAS Protein Family, Member 3 (WASF3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WASF3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-WASF3 Antibody

Binding Specificity: N-Term

Specificity: WASF3 antibody was raised against the N terminal of WASF3

Purification: Affinity purified

Immunogen: WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WASF3 Blocking Peptide, (ABIN5616988), is also available for use as a blocking control in assays to test for specificity of this WASF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WASF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WASF3

Target: WASF3 (WAS Protein Family, Member 3 (WASF3))

Alternative Name: WASF3

Background: WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: RTK Signaling