EHD4 antibody (Middle Region)

Catalog No. ABIN631254

This anti-EHD4 antibody is a Rabbit Polyclonal antibody detecting EHD4 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for EHD4 antibody (Middle Region) (ABIN631254)

Target: EHD4 (EH-Domain Containing 4 (EHD4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EHD4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EHD4 Antibody

Binding Specificity: Middle Region

Specificity: EHD4 antibody was raised against the middle region of EHD4

Purification: Affinity purified

Immunogen: EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EHD4 Blocking Peptide, (ABIN5613320), is also available for use as a blocking control in assays to test for specificity of this EHD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EHD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EHD4

Target: EHD4 (EH-Domain Containing 4 (EHD4))

Alternative Name: EHD4

Background: EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.

Molecular Weight: 61 kDa (MW of target protein)