TEX14 antibody (C-Term)

Catalog No. ABIN631261

Product Details anti-TEX14 Antibody

Target: TEX14 (Testis Expressed 14 (TEX14))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TEX14 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TEX14 antibody was raised against the C terminal of TEX14

Purification: Affinity purified

Immunogen: TEX14 antibody was raised using the C terminal of TEX14 corresponding to a region with amino acids ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TEX14 Blocking Peptide, catalog no. 33R-1529, is also available for use as a blocking control in assays to test for specificity of this TEX14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEX14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TEX14

Target: TEX14 (Testis Expressed 14 (TEX14))

Alternative Name: TEX14 (TEX14 Products)

Synonyms: CT113 antibody, C85585 antibody, testis expressed 14, intercellular bridge forming factor antibody, testis expressed gene 14 antibody, inactive serine/threonine-protein kinase TEX14 antibody, TEX14 antibody, Tex14 antibody, tex14 antibody, LOC100389169 antibody

Background: TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity. This gene is similar to a mouse gene that is expressed in the testis.

Molecular Weight: 160 kDa (MW of target protein)

Pathways: Maintenance of Protein Location