NUDCD1 antibody (N-Term)

Catalog No. ABIN631265

The Rabbit Polyclonal anti-NUDCD1 antibody has been validated for WB. It is suitable to detect NUDCD1 in samples from Human, Mouse and Rat.

Quick Overview for NUDCD1 antibody (N-Term) (ABIN631265)

Target: NUDCD1 (NudC Domain Containing 1 (NUDCD1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUDCD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NUDCD1 Antibody

Binding Specificity: N-Term

Specificity: NUDCD1 antibody was raised against the N terminal of NUDCD1

Purification: Affinity purified

Immunogen: NUDCD1 antibody was raised using the N terminal of NUDCD1 corresponding to a region with amino acids EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUDCD1 Blocking Peptide, (ABIN938159), is also available for use as a blocking control in assays to test for specificity of this NUDCD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDCD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUDCD1

Target: NUDCD1 (NudC Domain Containing 1 (NUDCD1))

Alternative Name: NUDCD1

Background: NUDCD1 (CML66) contains 1 CS domain. It may play an oncogenic role in ways of favoring tumor cells proliferation, invasion and metastasis-associated with multiple pathways.

Molecular Weight: 67 kDa (MW of target protein)