UNC45A antibody

Catalog No. ABIN631276

This Rabbit Polyclonal antibody specifically detects UNC45A in WB. It exhibits reactivity toward Human.

Quick Overview for UNC45A antibody (ABIN631276)

Target: UNC45A (Unc-45 Homolog A (UNC45A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UNC45A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UNC45A Antibody

Purification: Affinity purified

Immunogen: UNC45 A antibody was raised using a synthetic peptide corresponding to a region with amino acids REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UNC45A Blocking Peptide, (ABIN5616909), is also available for use as a blocking control in assays to test for specificity of this UNC45A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UNC45A

Target: UNC45A (Unc-45 Homolog A (UNC45A))

Alternative Name: UNC45A

Background: UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor and HSP90, and acts as a regulator of the progesterone receptor chaperoning pathway.

Molecular Weight: 102 kDa (MW of target protein)