INMT antibody (N-Term)

Catalog No. ABIN631293

Product Details anti-INMT Antibody

Target: INMT (Indolethylamine N-Methyltransferase (INMT))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This INMT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: INMT antibody was raised against the N terminal of INMT

Purification: Affinity purified

Immunogen: INMT antibody was raised using the N terminal of INMT corresponding to a region with amino acids KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

INMT Blocking Peptide, catalog no. 33R-4392, is also available for use as a blocking control in assays to test for specificity of this INMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for INMT

Target: INMT (Indolethylamine N-Methyltransferase (INMT))

Alternative Name: INMT (INMT Products)

Synonyms: TEMT antibody, Temt antibody, MGC68598 antibody, INMT antibody, nnmt antibody, indolethylamine N-methyltransferase antibody, indolethylamine N-methyltransferase L homeolog antibody, nicotinamide N-methyltransferase antibody, INMT antibody, Inmt antibody, inmt.L antibody, LOC489397 antibody, inmt antibody

Background: N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine.

Molecular Weight: 29 kDa (MW of target protein)