Nitrilase 1 antibody (N-Term)

Catalog No. ABIN631305

Product Details anti-Nitrilase 1 Antibody

Target: Nitrilase 1 (NIT1)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nitrilase 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NIT1 antibody was raised against the N terminal of NIT1

Purification: Affinity purified

Immunogen: NIT1 antibody was raised using the N terminal of NIT1 corresponding to a region with amino acids VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NIT1 Blocking Peptide, catalog no. 33R-9769, is also available for use as a blocking control in assays to test for specificity of this NIT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Nitrilase 1

Target: Nitrilase 1 (NIT1)

Alternative Name: NIT1 (NIT1 Products)

Synonyms: MGC85476 antibody, zgc:101630 antibody, ZmNIT1 antibody, DDBDRAFT_0217173 antibody, DDBDRAFT_0302491 antibody, DDB_0217173 antibody, DDB_0302491 antibody, AI255805 antibody, ESTM30 antibody, W57327 antibody, A. THALIANA NITRILASE 1 antibody, ATNIT1 antibody, NITI antibody, NITRILE AMINOHYDROLASE antibody, nitrilase 1 antibody, nitrilase 1 S homeolog antibody, nitrilase 1 antibody, nit1.S antibody, nit1 antibody, NIT1 antibody, nit1-2 antibody, Nit1 antibody

Background: NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. NIT1 has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells.

Molecular Weight: 36 kDa (MW of target protein)