FBXL5 antibody (Middle Region)

Catalog No. ABIN631308

Product Details anti-FBXL5 Antibody

Target: FBXL5 (F-Box and Leucine-Rich Repeat Protein 5 (FBXL5))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXL5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXL5 antibody was raised against the middle region of FBXL5

Purification: Affinity purified

Immunogen: FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids LRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXL5 Blocking Peptide, catalog no. 33R-5399, is also available for use as a blocking control in assays to test for specificity of this FBXL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXL5

Target: FBXL5 (F-Box and Leucine-Rich Repeat Protein 5 (FBXL5))

Alternative Name: FBXL5 (FBXL5 Products)

Synonyms: fbxl5 antibody, MGC53238 antibody, FBXL5 antibody, FBL4 antibody, FBL5 antibody, FLR1 antibody, Fbl4 antibody, Fir4 antibody, wu:fb52d06 antibody, F-box and leucine rich repeat protein 5 antibody, F-box and leucine-rich repeat protein 5 S homeolog antibody, F-box and leucine-rich repeat protein 5 L homeolog antibody, F-box and leucine-rich repeat protein 5 antibody, FBXL5 antibody, fbxl5.S antibody, fbxl5.L antibody, fbxl5 antibody, Fbxl5 antibody

Background: FBXL5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis