PCGF6 antibody (Middle Region)

Catalog No. ABIN631335

Product Details anti-PCGF6 Antibody

Target: PCGF6 (Polycomb Group Ring Finger 6 (PCGF6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCGF6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCGF6 antibody was raised against the middle region of PCGF6

Purification: Affinity purified

Immunogen: PCGF6 antibody was raised using the middle region of PCGF6 corresponding to a region with amino acids TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCGF6 Blocking Peptide, catalog no. 33R-9248, is also available for use as a blocking control in assays to test for specificity of this PCGF6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCGF6

Target: PCGF6 (Polycomb Group Ring Finger 6 (PCGF6))

Alternative Name: PCGF6 (PCGF6 Products)

Synonyms: im:7144322 antibody, si:ch211-67n3.7 antibody, MBLR antibody, RNF134 antibody, 4933407A11Rik antibody, AI604840 antibody, Rnf134 antibody, polycomb group ring finger 6 antibody, PCGF6 antibody, pcgf6 antibody, Pcgf6 antibody

Background: The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1. PcG proteins are known to form protein complexes and function as transcription repressors. This protein has been shown to interact with some PcG proteins and act as a transcription repressor. The activity of this protein is found to be regulated by cell cycle dependent phosphorylation. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molecular Weight: 30 kDa (MW of target protein)