WWP2 antibody (Middle Region)

Catalog No. ABIN631357

This Rabbit Polyclonal antibody specifically detects WWP2 in WB and IHC. It exhibits reactivity toward Human, Mouse and Dog.

Quick Overview for WWP2 antibody (Middle Region) (ABIN631357)

Target: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WWP2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-WWP2 Antibody

Binding Specificity: Middle Region

Specificity: WWP2 antibody was raised against the middle region of WWP2

Purification: Affinity purified

Immunogen: WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids EMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYH

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WWP2 Blocking Peptide, (ABIN937972), is also available for use as a blocking control in assays to test for specificity of this WWP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WWP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WWP2

Target: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Alternative Name: WWP2

Background: WWP2 is a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. WWP2 contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity