FBXO4 antibody (Middle Region)
-
- Target See all FBXO4 Antibodies
- FBXO4 (F-Box Protein 4 (FBXO4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FBXO4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FBXO4 antibody was raised against the middle region of FBXO4
- Purification
- Affinity purified
- Immunogen
- FBXO4 antibody was raised using the middle region of FBXO4 corresponding to a region with amino acids TSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKSK
- Top Product
- Discover our top product FBXO4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FBXO4 Blocking Peptide, catalog no. 33R-9277, is also available for use as a blocking control in assays to test for specificity of this FBXO4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO4 (F-Box Protein 4 (FBXO4))
- Alternative Name
- FBXO4 (FBXO4 Products)
- Synonyms
- FBX4 antibody, 1700096C12Rik antibody, AI851261 antibody, AW494535 antibody, Fbx4 antibody, FBXO4 antibody, fbx4 antibody, si:dkey-46a10.2 antibody, F-box protein 4 antibody, F-box protein 4 L homeolog antibody, FBXO4 antibody, Fbxo4 antibody, fbxo4 antibody, fbxo4.L antibody
- Background
- FBXO4 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO4 belongs to the Fbxs class.
- Molecular Weight
- 35 kDa (MW of target protein)
-