FBXO5 antibody (C-Term)

Catalog No. ABIN631366

Product Details anti-FBXO5 Antibody

Target: FBXO5 (F-Box Protein 5 (FBXO5))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FBXO5 antibody was raised against the C terminal of FBXO5

Purification: Affinity purified

Immunogen: FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO5 Blocking Peptide, catalog no. 33R-1541, is also available for use as a blocking control in assays to test for specificity of this FBXO5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO5

Target: FBXO5 (F-Box Protein 5 (FBXO5))

Alternative Name: FBXO5 (FBXO5 Products)

Synonyms: EMI1 antibody, FBX5 antibody, Fbxo31 antibody, 2510044I10Rik antibody, C85305 antibody, Emi1 antibody, emi1 antibody, fc65h02 antibody, wu:fc65h02 antibody, wu:fe06e07 antibody, wu:fz79f03 antibody, zgc:136397 antibody, zgc:158541 antibody, fbx5 antibody, Fbxo5 antibody, ACYPI007854 antibody, fbxo5 antibody, F-box protein 5 antibody, F-box only protein 5 antibody, F-box protein 5 L homeolog antibody, F-box protein 5 S homeolog antibody, FBXO5 antibody, Fbxo5 antibody, fbxo5 antibody, fbxo5.L antibody, fbxo5.S antibody

Background: FBXO5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases