FBXO11 antibody (Middle Region)

Catalog No. ABIN631382

The Rabbit Polyclonal anti-FBXO11 antibody has been validated for WB. It is suitable to detect FBXO11 in samples from Human, Mouse and Rat.

Quick Overview for FBXO11 antibody (Middle Region) (ABIN631382)

Target: FBXO11 (F-Box Protein 11 (FBXO11))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FBXO11 Antibody

Binding Specificity: Middle Region

Specificity: FBXO11 antibody was raised against the middle region of FBXO11

Purification: Affinity purified

Immunogen: FBXO11 antibody was raised using the middle region of FBXO11 corresponding to a region with amino acids HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO11 Blocking Peptide, (ABIN939099), is also available for use as a blocking control in assays to test for specificity of this FBXO11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO11

Target: FBXO11 (F-Box Protein 11 (FBXO11))

Alternative Name: FBXO11

Background: FBXO11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

Molecular Weight: 94 kDa (MW of target protein)

Pathways: Sensory Perception of Sound