GLYATL3 antibody (N-Term)

Catalog No. ABIN631402

Product Details anti-GLYATL3 Antibody

Target: GLYATL3 (Glycine-N-Acyltransferase-Like 3 (GLYATL3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLYATL3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C6 ORF140 antibody was raised against the N terminal Of C6 rf140

Purification: Affinity purified

Immunogen: C6 ORF140 antibody was raised using the N terminal Of C6 rf140 corresponding to a region with amino acids NPFQKEVVLDSWPDFKAVITRRQREAETDNLDHYTNAYAVFYKDVRAYRQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C6ORF140 Blocking Peptide, catalog no. 33R-6816, is also available for use as a blocking control in assays to test for specificity of this C6ORF140 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF140 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLYATL3

Target: GLYATL3 (Glycine-N-Acyltransferase-Like 3 (GLYATL3))

Alternative Name: C6ORF140 (GLYATL3 Products)

Synonyms: C6orf140 antibody, bA28H17.2 antibody, Gm5683 antibody, EG435528 antibody, glycine-N-acyltransferase like 3 antibody, glycine-N-acyltransferase-like 3 antibody, GLYATL3 antibody, Glyatl3 antibody

Background: C6orf140 encodes an acyltransferase which transfers the acyl group to the N-terminus of glycine.

Molecular Weight: 33 kDa (MW of target protein)