KLHL9 antibody
-
- Target See all KLHL9 Antibodies
- KLHL9 (Kelch-Like 9 (KLHL9))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KLHL9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- KLHL9 antibody was raised using a synthetic peptide corresponding to a region with amino acids SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY
- Top Product
- Discover our top product KLHL9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KLHL9 Blocking Peptide, catalog no. 33R-8307, is also available for use as a blocking control in assays to test for specificity of this KLHL9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHL9 (Kelch-Like 9 (KLHL9))
- Alternative Name
- KLHL9 (KLHL9 Products)
- Background
- KLHL9 is the substrate-specific adapter for a CUL3-based E3 ubiquitin-protein ligase complex. Within this complex, KLHL9 controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression.
- Molecular Weight
- 69 kDa (MW of target protein)
-