Klotho antibody (N-Term)

Catalog No. ABIN631412

The Rabbit Polyclonal anti-Klotho antibody has been validated for WB. It is suitable to detect Klotho in samples from Human.

Quick Overview for Klotho antibody (N-Term) (ABIN631412)

Target: Klotho (KL)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Klotho antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Klotho Antibody

Binding Specificity: N-Term

Specificity: Klotho antibody was raised against the n terminal of KL

Purification: Affinity purified

Immunogen: Klotho antibody was raised using the N terminal of KL corresponding to a region with amino acids FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Klotho Blocking Peptide, (ABIN938398), is also available for use as a blocking control in assays to test for specificity of this Klotho antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Klotho

Target: Klotho (KL)

Alternative Name: Klotho

Background: This gene encodes a type-I membrane protein that is related to beta-glucosidases. Reduced production of this protein has been observed in patients with chronic renal failure (CRF).

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hormone Activity, Growth Factor Binding