Klotho antibody (N-Term)
-
- Target See all Klotho (KL) Antibodies
- Klotho (KL)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Klotho antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Klotho antibody was raised against the n terminal of KL
- Purification
- Affinity purified
- Immunogen
- Klotho antibody was raised using the N terminal of KL corresponding to a region with amino acids FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP
- Top Product
- Discover our top product KL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Klotho Blocking Peptide, catalog no. 33R-3012, is also available for use as a blocking control in assays to test for specificity of this Klotho antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Klotho (KL)
- Alternative Name
- Klotho (KL Products)
- Background
- This gene encodes a type-I membrane protein that is related to beta-glucosidases. Reduced production of this protein has been observed in patients with chronic renal failure (CRF).
- Molecular Weight
- 60 kDa (MW of target protein)
- Pathways
- Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hormone Activity, Growth Factor Binding
-