ARCN1 antibody (Middle Region)

Catalog No. ABIN631413

Product Details anti-ARCN1 Antibody

Target: ARCN1 (Archain 1 (ARCN1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARCN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Archain 1 antibody was raised against the middle region of ARCN1

Purification: Affinity purified

Immunogen: Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Archain 1 Blocking Peptide, catalog no. 33R-3292, is also available for use as a blocking control in assays to test for specificity of this Archain 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARCN1

Target: ARCN1 (Archain 1 (ARCN1))

Alternative Name: Archain 1 (ARCN1 Products)

Synonyms: copd antibody, Tb08.5H5.420 antibody, COPD antibody, 4632432M07Rik antibody, nur17 antibody, arcn1 antibody, cb334 antibody, id:ibd3027 antibody, archain 1 antibody, coatomer delta subunit antibody, coatomer subunit delta antibody, Coatomer delta subunit antibody, archain 1 L homeolog antibody, archain 1a antibody, ARCN1 antibody, arcn1 antibody, Arcn1 antibody, Tc00.1047053503581.39 antibody, Tc00.1047053506573.91 antibody, Tc00.1047053511217.140 antibody, Tb927.8.5250 antibody, PVX_092350 antibody, LOC5577486 antibody, GL50803_6170 antibody, NAEGRDRAFT_79018 antibody, CC1G_00709 antibody, arcn1.L antibody, arcn1a antibody

Background: The gene that encodes ARCN1 maps in a region, which includes the mixed lineage leukemia and Friend leukemia virus integration 1 genes, where multiple disease-associated chromosome translocations occur. ARCN1 is an intracellular protein. Archain sequences are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking.

Molecular Weight: 57 kDa (MW of target protein)