RAB1A antibody (Middle Region)

Catalog No. ABIN631433

The Rabbit Polyclonal anti-RAB1A antibody is suitable to detect RAB1A in samples from Human, Mouse, Rat and Dog. It has been validated for WB.

Quick Overview for RAB1A antibody (Middle Region) (ABIN631433)

Target: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB1A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAB1A Antibody

Binding Specificity: Middle Region

Specificity: RAB1 A antibody was raised against the middle region of RAB1

Purification: Affinity purified

Immunogen: RAB1 A antibody was raised using the middle region of RAB1 corresponding to a region with amino acids AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB1A Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this RAB1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB1A

Target: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Alternative Name: RAB1A

Background: This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome