PARP9 antibody

Catalog No. ABIN631447

This Rabbit Polyclonal antibody specifically detects PARP9 in WB. It exhibits reactivity toward Human.

Quick Overview for PARP9 antibody (ABIN631447)

Target: PARP9 (Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARP9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PARP9 Antibody

Purification: Affinity purified

Immunogen: PARP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARP9 Blocking Peptide, (ABIN940399), is also available for use as a blocking control in assays to test for specificity of this PARP9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARP9

Target: PARP9 (Poly (ADP-Ribose) Polymerase Family, Member 9 (PARP9))

Alternative Name: PARP9

Background: PARP9 contains 2 Macro domains and 1 PARP catalytic domain. PARP9 is overexpressed at significantly higher levels in fatal high-risk diffuse large B-cell lymphomas (DLB-CL) compared to cured low-risk tumors. Overexpression of PARP9 in B-cell lymphoma transfectants may promote malignant B-cell migration. The function of PARP9 remains unknown.

Molecular Weight: 96 kDa (MW of target protein)