PAPSS2 antibody (C-Term)

Catalog No. ABIN631448

Product Details anti-PAPSS2 Antibody

Target: PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate Synthase 2 (PAPSS2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAPSS2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PAPSS2 antibody was raised against the C terminal of PAPSS2

Purification: Affinity purified

Immunogen: PAPSS2 antibody was raised using the C terminal of PAPSS2 corresponding to a region with amino acids PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAPSS2 Blocking Peptide, catalog no. 33R-6976, is also available for use as a blocking control in assays to test for specificity of this PAPSS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPSS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAPSS2

Target: PAPSS2 (3'-phosphoadenosine 5'-phosphosulfate Synthase 2 (PAPSS2))

Alternative Name: PAPSS2 (PAPSS2 Products)

Synonyms: ATPSK2 antibody, BCYM4 antibody, SK2 antibody, 1810018P12Rik antibody, AI159688 antibody, AtpsU2 antibody, Atpsk2 antibody, Sk2 antibody, bm antibody, Papss1 antibody, id:ibd2761 antibody, papss2 antibody, sb:cb868 antibody, wu:fb12e05 antibody, zgc:55851 antibody, zgc:85655 antibody, PAPSS2 antibody, zgc:153748 antibody, 3'-phosphoadenosine 5'-phosphosulfate synthase 2 antibody, 3'-phosphoadenosine 5'-phosphosulfate synthase 2b antibody, 3'-phosphoadenosine 5'-phosphosulfate synthase 2a antibody, PAPSS2 antibody, Papss2 antibody, papss2b antibody, papss2.S antibody, LOAG_05620 antibody, papss2 antibody, papss2a antibody

Background: Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. PAPSS2 is one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Ribonucleoside Biosynthetic Process