GALE antibody (N-Term)

Catalog No. ABIN631451

The Rabbit Polyclonal anti-GALE antibody has been validated for WB. It is suitable to detect GALE in samples from Human.

Quick Overview for GALE antibody (N-Term) (ABIN631451)

Target: GALE (UDP-Galactose-4-Epimerase (GALE))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALE antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GALE Antibody

Binding Specificity: N-Term

Specificity: GALE antibody was raised against the N terminal of GALE

Purification: Affinity purified

Immunogen: GALE antibody was raised using the N terminal of GALE corresponding to a region with amino acids AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALE Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this GALE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GALE

Target: GALE (UDP-Galactose-4-Epimerase (GALE))

Alternative Name: GALE

Background: GALE is an UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Cellular Glucan Metabolic Process