BLMH antibody (Middle Region)

Catalog No. ABIN631453

Product Details anti-BLMH Antibody

Target: BLMH (Bleomycin Hydrolase (BLMH))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BLMH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BLMH antibody was raised against the middle region of BLMH

Purification: Affinity purified

Immunogen: BLMH antibody was raised using the middle region of BLMH corresponding to a region with amino acids EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BLMH Blocking Peptide, catalog no. 33R-2825, is also available for use as a blocking control in assays to test for specificity of this BLMH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLMH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BLMH

Target: BLMH (Bleomycin Hydrolase (BLMH))

Alternative Name: BLMH (BLMH Products)

Synonyms: AI035728 antibody, Bh antibody, Bmh antibody, wu:fb13c01 antibody, zgc:66261 antibody, bh antibody, bmh antibody, BH antibody, BMH antibody, bleomycin hydrolase antibody, Bleomycin hydrolase antibody, bleomycin hydrolase S homeolog antibody, BLMH antibody, pepC antibody, LOC5569945 antibody, Apre_0140 antibody, Apar_0899 antibody, Smon_1289 antibody, Kfla_1242 antibody, Snas_3912 antibody, BLJ_1941 antibody, Olsu_1085 antibody, PGTDC60_0106 antibody, Blmh antibody, blmh antibody, blmh.S antibody

Background: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.

Molecular Weight: 52 kDa (MW of target protein)