COG2 antibody (N-Term)

Catalog No. ABIN631472

Product Details anti-COG2 Antibody

Target: COG2 (Conserved oligomeric Golgi complex subunit 2 (COG2))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COG2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: COG2 antibody was raised against the N terminal of COG2

Purification: Affinity purified

Immunogen: COG2 antibody was raised using the N terminal of COG2 corresponding to a region with amino acids KRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COG2 Blocking Peptide, catalog no. 33R-4640, is also available for use as a blocking control in assays to test for specificity of this COG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COG2

Target: COG2 (Conserved oligomeric Golgi complex subunit 2 (COG2))

Alternative Name: COG2 (COG2 Products)

Synonyms: zC8A9.2 antibody, zgc:56436 antibody, LDLC antibody, 1190002B08Rik antibody, 2700012E02Rik antibody, C86089 antibody, Ldlc antibody, component of oligomeric golgi complex 2 antibody, cog2 antibody, COG2 antibody, Cog2 antibody

Background: Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG2.

Molecular Weight: 83 kDa (MW of target protein)