TUBA4A antibody (Middle Region)

Catalog No. ABIN631484

Product Details anti-TUBA4A Antibody

Target: TUBA4A (Tubulin, alpha 4a (TUBA4A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Drosophila melanogaster, Arabidopsis, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUBA4A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Alpha Tubulin 4 A antibody was raised against the middle region of TUBA4

Purification: Affinity purified

Immunogen: alpha Tubulin 4 A antibody was raised using the middle region of TUBA4 corresponding to a region with amino acids GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

alpha Tubulin 4A Blocking Peptide, catalog no. 33R-3301, is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 4A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TUBA4A

Target: TUBA4A (Tubulin, alpha 4a (TUBA4A))

Alternative Name: alpha Tubulin 4A (TUBA4A Products)

Synonyms: TUBA1 antibody, TUBA6 antibody, H2-ALPHA antibody, M[a]4 antibody, Tuba4 antibody, tuba1 antibody, tubulin alpha 1a antibody, tubulin alpha 4a antibody, tubulin, alpha 4A antibody, tubulin alpha 4a L homeolog antibody, TUBA1A antibody, TUBA4A antibody, Tuba4a antibody, tuba4a.L antibody

Background: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Microtubule Dynamics, M Phase