Cytokeratin 7 antibody (N-Term)

Catalog No. ABIN631503

This anti-Cytokeratin 7 antibody is a Rabbit Polyclonal antibody detecting Cytokeratin 7 in WB. Suitable for Human.

Quick Overview for Cytokeratin 7 antibody (N-Term) (ABIN631503)

Target: Cytokeratin 7 (KRT7) (Keratin 7 (KRT7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cytokeratin 7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Cytokeratin 7 Antibody

Binding Specificity: N-Term

Specificity: Cytokeratin 7 antibody was raised against the N terminal of KRT7

Purification: Affinity purified

Immunogen: Cytokeratin 7 antibody was raised using the N terminal of KRT7 corresponding to a region with amino acids SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 7 Blocking Peptide, (ABIN5613107), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cytokeratin 7

Target: Cytokeratin 7 (KRT7) (Keratin 7 (KRT7))

Alternative Name: Cytokeratin 7

Background: KRT7 is a member of the keratin protein family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Molecular Weight: 52 kDa (MW of target protein)