POLR1B antibody

Catalog No. ABIN631507

Product Details anti-POLR1B Antibody

Target: POLR1B (Polymerase (RNA) I Polypeptide B, 128kDa (POLR1B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLR1B antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: POLR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLR1B Blocking Peptide, catalog no. 33R-8358, is also available for use as a blocking control in assays to test for specificity of this POLR1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLR1B

Target: POLR1B (Polymerase (RNA) I Polypeptide B, 128kDa (POLR1B))

Alternative Name: POLR1B (POLR1B Products)

Synonyms: RPOL-1l antibody, MGC68946 antibody, 128kDa antibody, D630020H17Rik antibody, RPA116 antibody, RPA135 antibody, RPA2 antibody, Rpo1-2 antibody, RNA polymerase I subunit B antibody, polymerase (RNA) I polypeptide B L homeolog antibody, polymerase (RNA) I polypeptide B, 128kDa antibody, polymerase (RNA) I polypeptide B antibody, DNA-directed RNA polymerase I subunit RPA2 antibody, POLR1B antibody, polr1b.L antibody, polr1b antibody, LOC100563266 antibody, LOC100634236 antibody, Polr1b antibody

Background: Eukaryotic RNA polymerase I (pol I) is responsible for the transcription of ribosomal RNA (rRNA) genes and production of rRNA, the primary component of ribosomes. Pol I is a multisubunit enzyme composed of 6 to 14 polypeptides, depending on the species.

Molecular Weight: 128 kDa (MW of target protein)