ACAA1 antibody
-
- Target See all ACAA1 Antibodies
- ACAA1 (Acetyl-CoA Acyltransferase 1 (ACAA1))
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACAA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD
- Top Product
- Discover our top product ACAA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACAA1 Blocking Peptide, catalog no. 33R-1110, is also available for use as a blocking control in assays to test for specificity of this ACAA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACAA1 (Acetyl-CoA Acyltransferase 1 (ACAA1))
- Alternative Name
- ACAA1 (ACAA1 Products)
- Background
- ACAA1 is an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-