DRG1 antibody (Middle Region)

Catalog No. ABIN631526

Product Details anti-DRG1 Antibody

Target: DRG1 (Developmentally Regulated GTP Binding Protein 1 (DRG1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DRG1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DRG1 antibody was raised against the middle region of DRG1

Purification: Affinity purified

Immunogen: DRG1 antibody was raised using the middle region of DRG1 corresponding to a region with amino acids VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DRG1 Blocking Peptide, catalog no. 33R-9670, is also available for use as a blocking control in assays to test for specificity of this DRG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DRG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DRG1

Target: DRG1 (Developmentally Regulated GTP Binding Protein 1 (DRG1))

Alternative Name: DRG1 (DRG1 Products)

Synonyms: NEDD3 antibody, wu:fb06g12 antibody, zgc:64124 antibody, xdrg antibody, xdrg1 antibody, MGC122865 antibody, AA408859 antibody, AI132520 antibody, Nedd3 antibody, developmentally regulated GTP binding protein 1 antibody, developmentally regulated GTP binding protein 1 L homeolog antibody, DRG1 antibody, Drg1 antibody, drg1 antibody, drg1.L antibody

Background: DRG1 belongs to the GTP1/OBG family.It may play a role in cell proliferation, differentiation and death.

Molecular Weight: 26 kDa (MW of target protein)