DRG1 antibody (Middle Region)
-
- Target See all DRG1 Antibodies
- DRG1 (Developmentally Regulated GTP Binding Protein 1 (DRG1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DRG1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DRG1 antibody was raised against the middle region of DRG1
- Purification
- Affinity purified
- Immunogen
- DRG1 antibody was raised using the middle region of DRG1 corresponding to a region with amino acids VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL
- Top Product
- Discover our top product DRG1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DRG1 Blocking Peptide, catalog no. 33R-9670, is also available for use as a blocking control in assays to test for specificity of this DRG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DRG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DRG1 (Developmentally Regulated GTP Binding Protein 1 (DRG1))
- Alternative Name
- DRG1 (DRG1 Products)
- Synonyms
- NEDD3 antibody, wu:fb06g12 antibody, zgc:64124 antibody, xdrg antibody, xdrg1 antibody, MGC122865 antibody, AA408859 antibody, AI132520 antibody, Nedd3 antibody, developmentally regulated GTP binding protein 1 antibody, developmentally regulated GTP binding protein 1 L homeolog antibody, DRG1 antibody, Drg1 antibody, drg1 antibody, drg1.L antibody
- Background
- DRG1 belongs to the GTP1/OBG family.It may play a role in cell proliferation, differentiation and death.
- Molecular Weight
- 26 kDa (MW of target protein)
-