METTL6 antibody (N-Term)

Catalog No. ABIN631546

Product Details anti-METTL6 Antibody

Target: METTL6 (Methyltransferase Like 6 (METTL6))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METTL6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: METTL6 antibody was raised against the N terminal of METTL6

Purification: Affinity purified

Immunogen: METTL6 antibody was raised using the N terminal of METTL6 corresponding to a region with amino acids QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

METTL6 Blocking Peptide, catalog no. 33R-7606, is also available for use as a blocking control in assays to test for specificity of this METTL6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for METTL6

Target: METTL6 (Methyltransferase Like 6 (METTL6))

Alternative Name: METTL6 (METTL6 Products)

Synonyms: zgc:56175 antibody, zgc:76943 antibody, 1600013P15Rik antibody, AI467521 antibody, AU020711 antibody, methyltransferase like 6 antibody, methyltransferase like 6 L homeolog antibody, mettl6 antibody, mettl6.L antibody, METTL6 antibody, Mettl6 antibody

Background: METTL6 is a probable methyltransferase.

Molecular Weight: 33 kDa (MW of target protein)