GSTa5 antibody (Middle Region)

Catalog No. ABIN631548

This anti-GSTa5 antibody is a Rabbit Polyclonal antibody detecting GSTa5 in WB. Suitable for Human.

Quick Overview for GSTa5 antibody (Middle Region) (ABIN631548)

Target: GSTa5 (Glutathione S-Transferase alpha 5 (GSTa5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GSTa5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GSTa5 Antibody

Binding Specificity: Middle Region

Specificity: GSTA5 antibody was raised against the middle region of GSTA5

Purification: Affinity purified

Immunogen: GSTA5 antibody was raised using the middle region of GSTA5 corresponding to a region with amino acids QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSTA5 Blocking Peptide, catalog no. 33R-7675, is also available for use as a blocking control in assays to test for specificity of this GSTA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GSTa5

Target: GSTa5 (Glutathione S-Transferase alpha 5 (GSTa5))

Alternative Name: GSTA5

Background: GSTA5 belongs to the GST superfamily, alpha family. It contains 1 GST C-terminal domain and 1 GST N-terminal domain. The exact functions of GSTA5 remain unknown.

Molecular Weight: 26 kDa (MW of target protein)