TIGD4 antibody (N-Term)

Catalog No. ABIN631561

Product Details anti-TIGD4 Antibody

Target: TIGD4 (Tigger Transposable Element Derived 4 (TIGD4))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TIGD4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TIGD4 antibody was raised against the N terminal of TIGD4

Purification: Affinity purified

Immunogen: TIGD4 antibody was raised using the N terminal of TIGD4 corresponding to a region with amino acids RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TIGD4 Blocking Peptide, catalog no. 33R-7898, is also available for use as a blocking control in assays to test for specificity of this TIGD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIGD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TIGD4

Target: TIGD4 (Tigger Transposable Element Derived 4 (TIGD4))

Alternative Name: TIGD4 (TIGD4 Products)

Synonyms: C130063O11Rik antibody, Gm418 antibody, tigger transposable element derived 4 antibody, PGTG_00971 antibody, Tigd4 antibody, TIGD4 antibody

Background: The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.

Molecular Weight: 57 kDa (MW of target protein)