COG4 antibody (Middle Region)

Catalog No. ABIN631569

This anti-COG4 antibody is a Rabbit Polyclonal antibody detecting COG4 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for COG4 antibody (Middle Region) (ABIN631569)

Target: COG4 (Component of Oligomeric Golgi Complex 4 (COG4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COG4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-COG4 Antibody

Binding Specificity: Middle Region

Specificity: COG4 antibody was raised against the middle region of COG4

Purification: Affinity purified

Immunogen: COG4 antibody was raised using the middle region of COG4 corresponding to a region with amino acids LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COG4 Blocking Peptide, (ABIN940335), is also available for use as a blocking control in assays to test for specificity of this COG4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COG4

Target: COG4 (Component of Oligomeric Golgi Complex 4 (COG4))

Alternative Name: COG4

Background: Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4.

Molecular Weight: 89 kDa (MW of target protein)