RPL37A antibody (Middle Region)

Catalog No. ABIN631577

Product Details anti-RPL37A Antibody

Target: RPL37A (Ribosomal Protein L37a (RPL37A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL37A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPL37 A antibody was raised against the middle region of RPL37

Purification: Affinity purified

Immunogen: RPL37 A antibody was raised using the middle region of RPL37 corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL37A Blocking Peptide, catalog no. 33R-1703, is also available for use as a blocking control in assays to test for specificity of this RPL37A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL37A

Target: RPL37A (Ribosomal Protein L37a (RPL37A))

Alternative Name: RPL37A (RPL37A Products)

Synonyms: L37A antibody, BcDNA:RE23595 antibody, BcDNA:RH41593 antibody, CG5827 antibody, DmL37a antibody, Dmel\\CG5827 antibody, M(2)25C antibody, M(2)S1 antibody, RpL37a antibody, l(2)25Cb antibody, CG9091 antibody, Dmel\\CG9091 antibody, RpL37 antibody, RpL37A antibody, RGD1561181 antibody, Rpl37a antibody, ribosomal protein L37a antibody, Ribosomal protein L37A antibody, ribosomal protein L37a L homeolog antibody, Ribosomal protein L37a antibody, ribosomal protein L37a, pseudogene 1 antibody, RPL37A antibody, Rpl37a antibody, RpL37A antibody, rpl37a.L antibody, RpL37a antibody, Rpl37a-ps1 antibody

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 10 kDa (MW of target protein)