RPS15A antibody (Middle Region)

Catalog No. ABIN631582

Product Details anti-RPS15A Antibody

Target: RPS15A (RA) (Ribosomal Protein S15a (RA))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS15A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPS15 A antibody was raised against the middle region of RPS15

Purification: Affinity purified

Immunogen: RPS15 A antibody was raised using the middle region of RPS15 corresponding to a region with amino acids KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS15A Blocking Peptide, catalog no. 33R-4269, is also available for use as a blocking control in assays to test for specificity of this RPS15A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS15A

Target: RPS15A (RA) (Ribosomal Protein S15a (RA))

Alternative Name: RPS15A (RA Products)

Synonyms: S15a antibody, A630031B11Rik antibody, wu:fb04b07 antibody, ribosomal protein S15a antibody, ribosomal protein S15A antibody, ribosomal protein S15a S homeolog antibody, 40S ribosomal protein S15a antibody, Rps15a antibody, RPS15A antibody, rps15a antibody, rps15a.S antibody, LOC619131 antibody

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit.

Molecular Weight: 15 kDa (MW of target protein)