ATP6V1A antibody (N-Term)
-
- Target See all ATP6V1A Antibodies
- ATP6V1A (ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP6V1A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP6 V6 antibody was raised against the N terminal of ATP6 6
- Purification
- Affinity purified
- Immunogen
- ATP6 V6 antibody was raised using the N terminal of ATP6 6 corresponding to a region with amino acids SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR
- Top Product
- Discover our top product ATP6V1A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP6V1A Blocking Peptide, catalog no. 33R-8503, is also available for use as a blocking control in assays to test for specificity of this ATP6V1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP6V1A (ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A))
- Alternative Name
- ATP6V1A (ATP6V1A Products)
- Synonyms
- ATP6A1 antibody, ATP6V1A1 antibody, HO68 antibody, VA68 antibody, VPP2 antibody, Vma1 antibody, AI647066 antibody, Atp6a1 antibody, Atp6a2 antibody, Atp6v1a1 antibody, ATP6V1A antibody, atp6v1al antibody, zgc:63516 antibody, An02g10440 antibody, AO090102000349 antibody, vacuolar ATP synthase subunit A antibody, atp6a1 antibody, atp6v1a1 antibody, ho68 antibody, v1a antibody, va68 antibody, vma1 antibody, vpp2 antibody, CG12403 antibody, Dmel\CG12403 antibody, V-ATPase antibody, Vha antibody, Vha-68-1 antibody, Vha68 antibody, vha67-2 antibody, vha68-1 antibody, ATPase H+ transporting V1 subunit A antibody, ATPase, H+ transporting, lysosomal V1 subunit A antibody, ATPase, H+ transporting, lysosomal, V1 subunit Aa antibody, v-type proton ATPase catalytic subunit A antibody, vacuolar ATP synthase subunit A antibody, ATPase H+ transporting V1 subunit A L homeolog antibody, vacuolar proton pump 3 antibody, Vacuolar H[+] ATPase 68kD subunit 1 antibody, ATP6V1A antibody, Atp6v1a antibody, atp6v1aa antibody, ANI_1_1468024 antibody, AOR_1_602134 antibody, VHA-A antibody, atp6v1a.L antibody, vpp3 antibody, Vha68-1 antibody
- Background
- This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles.
- Molecular Weight
- 68 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Proton Transport, SARS-CoV-2 Protein Interactome
-