CENPQ antibody (N-Term)

Catalog No. ABIN631590

Product Details anti-CENPQ Antibody

Target: CENPQ (Centromere Protein Q (CENPQ))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CENPQ antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CENPQ antibody was raised against the N terminal of CENPQ

Purification: Affinity purified

Immunogen: CENPQ antibody was raised using the N terminal of CENPQ corresponding to a region with amino acids VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CENPQ Blocking Peptide, catalog no. 33R-9780, is also available for use as a blocking control in assays to test for specificity of this CENPQ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CENPQ

Target: CENPQ (Centromere Protein Q (CENPQ))

Alternative Name: CENPQ (CENPQ Products)

Synonyms: C6orf139 antibody, CENP-Q antibody, 2610528M18Rik antibody, centromere protein Q antibody, CENPQ antibody, cenpq antibody, Cenpq antibody

Background: CENPQ is a subunit of a CENPH-CENPI-associated centromeric complex that targets CENPA to centromeres and is required for proper kinetochore function and mitotic progression.

Molecular Weight: 30 kDa (MW of target protein)