SCYL3 antibody

Catalog No. ABIN631591

Product Details anti-SCYL3 Antibody

Target: SCYL3 (SCY1-Like 3 (SCYL3))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCYL3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCYL3 Blocking Peptide, catalog no. 33R-6074, is also available for use as a blocking control in assays to test for specificity of this SCYL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCYL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCYL3

Target: SCYL3 (SCY1-Like 3 (SCYL3))

Alternative Name: SCYL3 (SCYL3 Products)

Synonyms: RGD1308992 antibody, zgc:55575 antibody, wu:fc11d06 antibody, wu:faa95c04 antibody, 1200016D23RIK antibody, pace1 antibody, pace-1 antibody, MGC81481 antibody, rp1-97p20.2 antibody, PACE-1 antibody, PACE1 antibody, 1200016D23Rik antibody, 6030457O16 antibody, AW214499 antibody, Pace1 antibody, SCY1 like pseudokinase 3 antibody, SCY1-like, kinase-like 3 antibody, SCY1 like pseudokinase 3 L homeolog antibody, SCY1-like 3 (S. cerevisiae) antibody, Scyl3 antibody, scyl3 antibody, SCYL3 antibody, scyl3.L antibody

Background: SCYL3 may play a role in regulating cell adhesion/migration complexes in migrating cells.

Molecular Weight: 83 kDa (MW of target protein)