Catalase antibody (Middle Region)

Catalog No. ABIN631595

The Rabbit Polyclonal anti-Catalase antibody has been validated for WB. It is suitable to detect Catalase in samples from Human, Mouse, Dog. There is 1 publication available.

Quick Overview for Catalase antibody (Middle Region) (ABIN631595)

Target: Catalase (CAT)

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Catalase antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Catalase Antibody

Binding Specificity: Middle Region

Specificity: Catalase antibody was raised against the middle region of CAT

Purification: Affinity purified

Immunogen: Catalase antibody was raised using the middle region of CAT corresponding to a region with amino acids LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Catalase Blocking Peptide, catalog no. 33R-5077, is also available for use as a blocking control in assays to test for specificity of this Catalase antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-Catalase antibody (ABIN631595)

Makkar, Contreras, Paintlia, Smith, Haq, Singh: "Molecular organization of peroxisomal enzymes: protein-protein interactions in the membrane and in the matrix." in: Archives of biochemistry and biophysics, Vol. 451, Issue 2, pp. 128-40, (2006) (PubMed).

Target Details for Catalase

Target: Catalase (CAT)

Alternative Name: Catalase

Background: This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Cell RedoxHomeostasis, Photoperiodism