KPTN antibody

Catalog No. ABIN631596

This anti-KPTN antibody is a Rabbit Polyclonal antibody detecting KPTN in WB. Suitable for Human, Mouse and Rat.

Quick Overview for KPTN antibody (ABIN631596)

Target: KPTN (Kaptin (Actin Binding Protein) (KPTN))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KPTN antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KPTN Antibody

Purification: Affinity purified

Immunogen: Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Kaptin Blocking Peptide, (ABIN5614251), is also available for use as a blocking control in assays to test for specificity of this Kaptin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KPTN

Target: KPTN (Kaptin (Actin Binding Protein) (KPTN))

Alternative Name: Kaptin

Background: KPTN may be involved in actin dynamics. KPTN may play a role in producing the sensory apparatus in hair cells. KPTN may also play a role in actin rearrangements that accompany platelet activation and stereocilia formation.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Sensory Perception of Sound