RPL13A antibody (Middle Region)

Catalog No. ABIN631597

Product Details anti-RPL13A Antibody

Target: RPL13A (Ribosomal Protein L13a (RPL13A))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL13A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPL13 A antibody was raised against the middle region of RPL13

Purification: Affinity purified

Immunogen: RPL13 A antibody was raised using the middle region of RPL13 corresponding to a region with amino acids HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL13A Blocking Peptide, catalog no. 33R-3724, is also available for use as a blocking control in assays to test for specificity of this RPL13A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL13A

Target: RPL13A (Ribosomal Protein L13a (RPL13A))

Alternative Name: RPL13A (RPL13A Products)

Synonyms: 1810026N22Rik antibody, Tstap198-7 antibody, tum-antigen antibody, L13A antibody, TSTA1 antibody, CG1475 antibody, Dmel\\CG1475 antibody, L13a2 antibody, M(3)83B antibody, Rp L13A antibody, anon-EST:Posey125 antibody, anon-EST:fe1A5 antibody, bs25f04.y1 antibody, cg1475 antibody, MGC54018 antibody, GB16111 antibody, hm:zehp0384 antibody, wu:fa95e06 antibody, wu:fb08g07 antibody, wu:fd05d08 antibody, DDBDRAFT_0217704 antibody, DDBDRAFT_0231192 antibody, DDB_0217704 antibody, DDB_0231192 antibody, ribosomal protein L13A antibody, ribosomal protein L13a antibody, Ribosomal protein L13A antibody, ribosomal protein L13a S homeolog antibody, 60S ribosomal protein L13a antibody, ribosomal protein 13a antibody, ribosomal 60S subunit protein L13A antibody, Ribosomal protein L13a, component of cytosolic 80S ribosome and 60S large subunit antibody, S60 ribosomal protein L13a antibody, Rpl13a antibody, RPL13A antibody, RpL13A antibody, rpl13a.S antibody, rpl13a antibody, LOC551418 antibody, LOC663151 antibody, RPL13a antibody

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 22 kDa (MW of target protein)