alpha KGDHC antibody (N-Term)

Catalog No. ABIN631602

Product Details anti-alpha KGDHC Antibody

Target: alpha KGDHC (alphaKGDHC) (alpha Ketoglutarate Dehydrogenase (alphaKGDHC))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This alpha KGDHC antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OGDH antibody was raised against the N terminal of OGDH

Purification: Affinity purified

Immunogen: OGDH antibody was raised using the N terminal of OGDH corresponding to a region with amino acids MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OGDH Blocking Peptide, catalog no. 33R-5994, is also available for use as a blocking control in assays to test for specificity of this OGDH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OGDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for alpha KGDHC

Target: alpha KGDHC (alphaKGDHC) (alpha Ketoglutarate Dehydrogenase (alphaKGDHC))

Alternative Name: OGDH (alphaKGDHC Products)

Synonyms: AKGDH antibody, E1k antibody, OGDC antibody, 2210403E04Rik antibody, 2210412K19Rik antibody, AA409584 antibody, d1401 antibody, mKIAA4192 antibody, oxoglutarate dehydrogenase antibody, oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide) antibody, OGDH antibody, Ogdh antibody

Background: The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO2. It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).

Molecular Weight: 47 kDa (MW of target protein)